API / apply for access

Let AI Agentsconnect to a real lab.

Connect computational design with experimental validation: submit candidate sequences, track experiment progress, and send structured results into the next model iteration.

Read the API draft
API flow / interactive demo

Explore each step from experiment creation to structured results. All examples are illustrative, not a live API contract.

01

Create experiment

POST/experiments

Select experiment type and target protein, adjust sequences and replicates; the request example on the right updates in sync.

Experiment type

Candidate sequencesDemo IgG sample
6 / 6
POSThttps://api.example.com/v1/experiments
{
  "experiment_spec": {
    "experiment_type": "screening",
    "target_id": "target_pdcd1",
    "sequences": {
      "IgG-Seq1-H": "EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYAMSWVRQAPGKGLEWVSAISGSGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKDRGSYRYDGYFDYWGQGTLVTVSS",
      "IgG-Seq1-L": "DIQMTQSPSSLSASVGDRVTITCRASQSVSSSYLAWYQQKPGKAPKLLIYDASNLETGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQYNSYPLTFGGGTKVEIK",
      "IgG-Seq2-H": "QVQLVESGGGVVQPGRSLRLDCKASGITFSNDYGMHWVRQAPGKGLEWVAVIWYDGSKRYYADSVKGRFTISRDNSKNTLFLQMNSLRAEDTAVYYCARDRGYYGYDVFAYWGQGTLVTVSS",
      "IgG-Seq2-L": "EIVLTQSPATLSLSPGERATLSCRASKSVSTSGYSHLHWYQQKPGQAPRLLIYLASEYLESGVPARFSGSGSGTDFTLTISSLEPEDFAVYYCQHSRELPYTFGGGTKVEIK",
      "IgG-Seq3-H": "EVQLVESGGGLVQPGGSLRLSCAASGFTFDDYAISWVRQAPGKGLEWVSRIPSDSGSTKYAPSVKGRFTISRDNSKNTLFLQMNSLRAEDTAVYYCASSLGGYAEYFAYWGQGTLVTVSS",
      "IgG-Seq3-L": "DIVMTQSPSSLSASLGDRVTITCRASENIYSYLAWYQQKPGKAPKLLIYAASTLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQKYNSAPLTFGGGTKVEIK"
    },
    "n_replicates": 1
  }
}
02

Track progress

GET/experiments/{id}/updates

Track the experiment lifecycle via API or webhook. Click any event and the response on the right switches accordingly.

Response200 OK
GEThttps://api.example.com/v1/experiments/exp_demo_042/updates
{
  "items": [
    {
      "id": "upd-01",
      "experiment_id": "exp_demo_042",
      "experiment_code": "ML-DEMO-042",
      "type": "status_change",
      "title": "Experiment created",
      "content": "48 candidate pairs targeting PD-1 were received.",
      "status": "draft",
      "timestamp": "2026-09-17T07:19:25.195Z"
    }
  ],
  "total": 8,
  "has_more": true
}
03

View results

GET/experiments/{id}/results

View binding data for candidate sequences. Switch between chart and table; select a sample to view the corresponding structured response.

Strong binding · 8 samples · KD < 1 nMModerate binding · 24 samples · 1–100 nMWeak binding · 16 samples · 100–1000 nM
0.11101001000

KD (nM) — lower values mean stronger binding

Current sampleIgG-Seq03KD 0.14 nM · Strong binding
See separate CSV attachment
200 OK
GEThttps://api.example.com/v1/experiments/exp_demo_042/results
{
  "items": [
    {
      "id": "result-03",
      "sequence_id": "igg-seq03",
      "sequence_name": "IgG-Seq03",
      "target_name": "PD-1 / PDCD1",
      "experiment_id": "exp_demo_042",
      "kd": 1.4000000000000003e-10,
      "kd_units": "M",
      "kon": 185000,
      "koff": 0.000026,
      "binding_strength": "strong"
    }
  ],
  "total": 48
}
Connect the loop

Plan the first integration together.

Tell us what your design workflow needs; we can jointly assess experiment scope and integration approach.

Inquire about API access