Let AI Agentsconnect to a real lab.
Connect computational design with experimental validation: submit candidate sequences, track experiment progress, and send structured results into the next model iteration.
Read the API draftExplore each step from experiment creation to structured results. All examples are illustrative, not a live API contract.
Create experiment
/experimentsSelect experiment type and target protein, adjust sequences and replicates; the request example on the right updates in sync.
Experiment type
{
"experiment_spec": {
"experiment_type": "screening",
"target_id": "target_pdcd1",
"sequences": {
"IgG-Seq1-H": "EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYAMSWVRQAPGKGLEWVSAISGSGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKDRGSYRYDGYFDYWGQGTLVTVSS",
"IgG-Seq1-L": "DIQMTQSPSSLSASVGDRVTITCRASQSVSSSYLAWYQQKPGKAPKLLIYDASNLETGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQYNSYPLTFGGGTKVEIK",
"IgG-Seq2-H": "QVQLVESGGGVVQPGRSLRLDCKASGITFSNDYGMHWVRQAPGKGLEWVAVIWYDGSKRYYADSVKGRFTISRDNSKNTLFLQMNSLRAEDTAVYYCARDRGYYGYDVFAYWGQGTLVTVSS",
"IgG-Seq2-L": "EIVLTQSPATLSLSPGERATLSCRASKSVSTSGYSHLHWYQQKPGQAPRLLIYLASEYLESGVPARFSGSGSGTDFTLTISSLEPEDFAVYYCQHSRELPYTFGGGTKVEIK",
"IgG-Seq3-H": "EVQLVESGGGLVQPGGSLRLSCAASGFTFDDYAISWVRQAPGKGLEWVSRIPSDSGSTKYAPSVKGRFTISRDNSKNTLFLQMNSLRAEDTAVYYCASSLGGYAEYFAYWGQGTLVTVSS",
"IgG-Seq3-L": "DIVMTQSPSSLSASLGDRVTITCRASENIYSYLAWYQQKPGKAPKLLIYAASTLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQKYNSAPLTFGGGTKVEIK"
},
"n_replicates": 1
}
}Track progress
/experiments/{id}/updatesTrack the experiment lifecycle via API or webhook. Click any event and the response on the right switches accordingly.
{
"items": [
{
"id": "upd-01",
"experiment_id": "exp_demo_042",
"experiment_code": "ML-DEMO-042",
"type": "status_change",
"title": "Experiment created",
"content": "48 candidate pairs targeting PD-1 were received.",
"status": "draft",
"timestamp": "2026-09-17T07:19:25.195Z"
}
],
"total": 8,
"has_more": true
}View results
/experiments/{id}/resultsView binding data for candidate sequences. Switch between chart and table; select a sample to view the corresponding structured response.
KD (nM) — lower values mean stronger binding
{
"items": [
{
"id": "result-03",
"sequence_id": "igg-seq03",
"sequence_name": "IgG-Seq03",
"target_name": "PD-1 / PDCD1",
"experiment_id": "exp_demo_042",
"kd": 1.4000000000000003e-10,
"kd_units": "M",
"kon": 185000,
"koff": 0.000026,
"binding_strength": "strong"
}
],
"total": 48
}Plan the first integration together.
Tell us what your design workflow needs; we can jointly assess experiment scope and integration approach.
Inquire about API access